Designing of immunogenic peptides from Dengue Virus NS1 region for production of monoclonal antibodies as diagnostic intermediates

dc.contributor.authorMunasinghe, M.M.E.
dc.contributor.authorChandrasekharan, N.V.
dc.contributor.authorKorbakis, D.
dc.contributor.authorSoosaipillai, A.
dc.contributor.authorDiamandis, E.P.
dc.contributor.authorAthapaththu, A.M.M.H.
dc.contributor.authorGunathilaka, P.A.D.H.N.
dc.contributor.authorAbeyewickreme, W.
dc.date.accessioned2015-12-17T09:33:06Z
dc.date.available2015-12-17T09:33:06Z
dc.date.issued2015
dc.descriptionKeynote Addressen_US
dc.description.abstractBACKGROUND: Small peptide antigens have become an essential tool for antibody production in the recent life science research applications. The immunogenicity of peptide antigens is a critical factor to induce the immune response in order to produce desired antibodies. METHODS: In the current study, we have previously determined four Dengue (DEN) serotype specific peptides, containing 28 Amino Acid (AA) residues were re-designed. The peptides were re-designed considering many factors, for instance, sequence of the Sri Lankan isolates, abundance of Cysteine residues, solubility and the length of the peptide, carrier protein to be used and several other factors such as the N-terminal and C- terminal AAs and multiple AA residues. The peptide sequences were analysed using Antigen Profiler Peptide Tool (Thermo-scientific), Peptide Property Calculator (Genscript) and Swiss-Model (Biozentrum). RESULTS: The protein sequence of the peptides were changed according to the Sri Lankan isolates (AEB98757.1, ACS32038.1, AHG23239.1 and AHN50410.1). Oxidation of Cysteine residues results in significant conformational changes. Replacement of Cysteine with Serine prevents such oxidation reactions and it often retains full biological activity. Generally, peptides with a high number of hydrophobic AA (>50%) may result insoluble peptides. Similarly, to obtain a soluble peptide, it is important to contain at least one charged AA in every five AAs. Hence, the number of hydrophobic residues in the peptides were maintained below 50% and ensured that one out of every five amino acids is charged. The length of the peptide is an important factor as long peptide increases immunogenicity, but also increases the chance for cross-reactivity while a short peptide improves the specificity, but may not be immunogenic. In order to obtain both highly conserved and variable regions among four serotypes, the peptide length was determined as 29 residues. A terminal Cysteine was added to allow peptide conjugation with carrier protein. Keyhole Limpet Hemocyanin was selected as the carrier protein due to its higher immunogenicity. N-terminal Glutamine or Aspargine and C-terminal Proline or Glycine in the sequences were avoided. Finally, the peptides sequences were determined as: DEN1; CPESSDDQRA WNIWEVEDYGFGIFTTNIW,DEN2; CAESPN TNRA WNSLEVEDYGFGVFTTNIW, DEN3;CPESPSASRAWNVWEVEDYGFGVFTTNIW and .DEN4;CSESPNERRAWNSLEVEDYGFGMFTTNIW. CONCLUSION: These peptides have a high potential to be used as peptide antigens for Monoclonal Antibody production.en_US
dc.identifier.citationProceedings of the Current Research Activities on dengue conducted by the Faculty of Medicine, University of Kelaniya, Sri Lanka.2015:14en_US
dc.identifier.urihttp://repository.kln.ac.lk/handle/123456789/10890
dc.language.isoen_USen_US
dc.publisherMolecular Medicine Unit, Faculty of Medicine, University of Kelaniya, Sri Lankaen_US
dc.subjectNS1, Dengue Peptide, Amino Aciden_US
dc.titleDesigning of immunogenic peptides from Dengue Virus NS1 region for production of monoclonal antibodies as diagnostic intermediatesen_US
dc.typeArticleen_US

Files

License bundle

Now showing 1 - 1 of 1
Loading...
Thumbnail Image
Name:
license.txt
Size:
1.71 KB
Format:
Item-specific license agreed upon to submission
Description: